Loading...
Statistics
Advertisement

Putr.net

Advertisement
Conversion Technology Metas Server
Putr.net is hosted in United States / Scottsdale . Putr.net doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Putr.net

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Microsoft-IIS/7.5

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Putr.net

Missing HTTPS protocol.

    Meta - Putr.net

    Number of occurences: 0

    Server / Hosting

    • IP: 184.168.221.104
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns1.afternic.com

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 24 Aug 2016 07:08:22 GMT Server: Microsoft-IIS/7.5 Set-Cookie: COOKIE=10.22.16.235.1472022502042752; path=/ Set-Cookie: referrer=; path=/ Set-Cookie: t=8adcd4d069c911e69da95254004ce360; path=/ Set-Cookie: referrer=www.putr.net; path=/ Set-Cookie: caf_last_page_url=http://www.putr.net/; path=/ Set-Cookie: caf_remotehost=10.22.16.235; path=/ Set-Cookie: caf_referrer=http%3A%2F%2Fwww.putr.net%2F; path=/ Set-Cookie: caf_ipaddr=23.104.184.118; path=/ Set-Cookie: caf_geolocation=United+States; path=/ Set-Cookie: visitorxputr.net=1 Set-Cookie: Template--putr.net=Glassy; path=/ Set-Cookie: FeedProvider--putr.net=Google; path=/ Vary: Accept-Encoding,User-Agent Cartoon: p3planlander02 Content-Type: text/html; charset=UTF-8 Age: 0 X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: putr.net
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 184.168.221.104
    host: putr.net
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns1.afternic.com
    host: putr.net
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns1.afternic.com
    5. rname: dns.jomax.net
    6. serial: 2014091900
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.utr.net, www.piutr.net, www.iutr.net, www.pkutr.net, www.kutr.net, www.puutr.net, www.uutr.net, www.pjutr.net, www.jutr.net, www.plutr.net, www.lutr.net, www.ptr.net, www.puwtr.net, www.pwtr.net, www.puetr.net, www.petr.net, www.pustr.net, www.pstr.net, www.puatr.net, www.patr.net, www.pur.net, www.putqr.net, www.puqr.net, www.putar.net, www.puar.net, www.put r.net, www.pu r.net, www.putwr.net, www.puwr.net, www.puter.net, www.puer.net, www.putzr.net, www.puzr.net, www.putxr.net, www.puxr.net, www.putcr.net, www.pucr.net, www.put.net, www.putri.net, www.puti.net, www.putro.net, www.puto.net, www.putrl.net, www.putl.net, www.putrl.net, www.putl.net, www.putr..net, www.put..net,

    Other websites we recently analyzed

    1. nimeshpatelkatyfamilyphysicians.com
      Wayne (United States) - 74.208.62.82
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    2. Керамическая плитка, доставка Киев и область, низкие цены в магазине КЕРАМИКА | (044) 227-68-60
      Магазин-склад КЕРАМИКА - большой выбор керамической плитки, мозаики, керамогранита, клинкера. Бесплатная доставка по Киеву.
      Kiev (Ukraine) - 193.169.188.224
      G Analytics ID: UA-42873655-2
      Server software: nginx admin
      Technology: BootstrapCDN, CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery UI, PageSpeed Module, Php, Yandex.Metrika, Google Analytics
      Number of Javascript: 14
      Number of meta tags: 6
    3. robbaldwin.org
      Scottsdale (United States) - 184.168.221.53
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    4. cockerdamen.de
      Germany - 94.102.216.158
      Server software: Apache/2.2.9 (Debian) DAV/2 mod_ssl/2.2.9 OpenSSL/0.9.8g PHP/5.2.6-1+lenny9 with Suhosin-Patch
      Technology: Html
      Number of meta tags: 1
    5. nasira.com - Diese Website steht zum Verkauf! - Informationen zum Thema nasira.
      Diese Website steht zum Verkauf! nasira.com ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf nasira.com alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Cambridge (United States) - 72.52.4.90
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    6. Home - Prime RE Group
      Prime RE Group
      Brisbane (Australia) - 202.174.106.117
      Server software: Apache
      Technology: CloudFlare, Maxcdn, OSS CDN, CSS, Google Font API, Html, Html5, Iframe, Javascript, Modernizr.js, Php, SVG, New Relic
      Number of Javascript: 17
      Number of meta tags: 9
    7. parablesofthepotter.com
      Wayne (United States) - 74.208.215.37
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    8. antitrustguru.info
      Germany - 217.160.230.214
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    9. Joseph Medcalf Funeral Services
      Australia - 27.121.64.200
      Server software: Apache/2.2.24 (Unix) mod_ssl/2.2.24 OpenSSL/1.0.0-fips
      Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, jQuery Fancybox, Php, Pingback, SuperFish, Wordpress
      Number of Javascript: 18
      Number of meta tags: 3
    10. futureworthfollowing.com
      Scottsdale (United States) - 184.168.221.52
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe

    Check Other Websites